{"product_id":"proteintech-11166-2-ap","title":"Proteintech, 11166-2-AP, IDI1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IDI1 (11166-2-AP) by Proteintech is a Polyclonal antibody targeting IDI1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11166-2-AP targets IDI1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, human liver tissue,  mouse liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human prostate cancer tissue, human colon cancer tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:4000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIDI1(Isopentenyl-diphosphate Delta-isomerase 1) is a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP). It belongs to the IPP isomerase type 1 family. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 26 kDa and 32 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1636 Product name: Recombinant human IDI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-237 aa of BC019227 Sequence: VLEQIRHFVMMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDTLGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWDNLNHLNQFVDHEKIYRM Predict reactive species\nFull Name: isopentenyl-diphosphate delta isomerase 1\nCalculated Molecular Weight: 31 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC019227\nGene Symbol: IDI1\nGene ID (NCBI): 3422\nRRID: AB_2233532\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13907\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868955889833,"sku":"11166-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11166-2-ap","provider":"Iright","version":"1.0","type":"link"}