{"product_id":"proteintech-11172-1-ap","title":"Proteintech, 11172-1-AP, EAF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EAF2 (11172-1-AP) by Proteintech is a Polyclonal antibody targeting EAF2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11172-1-AP targets EAF2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse kidney tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nELL associated factor 1 and ELL associated factor 2 (EAF1\/2 factors) are reported to play important roles in tumor suppression and embryogenesis.\nThe tumor suppressor EAF2 is regulated by androgen signaling and associated with prostate cancer. Eaf factors have been revealed to modulate mesoderm and neural patterning by inhibiting canonical Wnt signaling, and high activity of canonical Wnt\/β-catenin is revealed in eafs morphants (PMID: 23364330).\nCatalog#11172-1-AP is a rabbit polyclonal antibody raised against the full-length of human EAF2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1637 Product name: Recombinant human EAF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-260 aa of BC014209 Sequence: MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD Predict reactive species\nFull Name: ELL associated factor 2\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC014209\nGene Symbol: EAF2\nGene ID (NCBI): 55840\nRRID: AB_2097560\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96CJ1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869533425833,"sku":"11172-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11172-1-ap","provider":"Iright","version":"1.0","type":"link"}