{"product_id":"proteintech-11192-1-ap","title":"Proteintech, 11192-1-AP, NEK9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NEK9 (11192-1-AP) by Proteintech is a Polyclonal antibody targeting NEK9 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n11192-1-AP targets NEK9 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human placenta tissue,  HepG2 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:9000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNEK9 is also named as KIAA1995, NEK8, NERCC and belongs to the NEK Ser\/Thr protein kinase family. It is originally identified as αβ-casein kinase that associates with a putative substrate Bicd2. It is also independently identified as a Nek6- and Ran GTPase-binding protein under a different name, Nercc1(PMID:14660563). Nek9, together with the highly similar (80% identical) Nek6 and Nek7, form a signaling module that is activated during mitosis and involved in the regulation of the mitotic spindle. The endogenous Nek9 (with predicted molecular mass of 120 kDa) has an apparent molecular mass of 600 kDa, also compatible with a tetramer(PMID:21454704).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1678 Product name: Recombinant human NEK9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 734-979 aa of BC009336 Sequence: RSNSSGLSIGTVFQSSSPGGGGGGGGGEEEDSQQESETPDPSGGFRGTMEADRGMEGLISPTEAMGNSNGASSSCPGWLRKELENAEFIPMPDSPSPLSAAFSESEKDTLPYEELQGLKVASEAPLEHKPQVEASSPRLNPAVTCAGKGTPLTPPACACSSLQVEVERLQGLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKPDLDSDSWCLLGTDSCRPSL Predict reactive species\nFull Name: NIMA (never in mitosis gene a)- related kinase 9\nCalculated Molecular Weight: 107 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: BC009336\nGene Symbol: NEK9\nGene ID (NCBI): 91754\nRRID: AB_2150800\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TD19\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869418508457,"sku":"11192-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11192-1-ap","provider":"Iright","version":"1.0","type":"link"}