{"product_id":"proteintech-11193-1-ap","title":"Proteintech, 11193-1-AP, EIF1AY Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF1AY (11193-1-AP) by Proteintech is a Polyclonal antibody targeting EIF1AY in WB, IF\/ICC, ELISA applications with reactivity to human samples\n11193-1-AP targets EIF1AY in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF7 cells, MCF-7 cells,  HEK-293 cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEIF1AY is 1 of 5 NRY genes that are expressed in many tissues and have homologs on the X chromosome, which is an essential translation initiation factor. EIF1AY seems to be required for maximal rate of protein biosynthesis, and enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits. This is a rabbit polyclonal antibody raised against the full length of human EIF1AY, and can recognize both EIF1AY and EIF1AX.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1680 Product name: Recombinant human EIF1AY protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC005248 Sequence: MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI Predict reactive species\nFull Name: eukaryotic translation initiation factor 1A, Y-linked\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16-20 kDa\nGenBank Accession Number: BC005248\nGene Symbol: EIF1AY\nGene ID (NCBI): 9086\nRRID: AB_2262159\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14602\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887476756649,"sku":"11193-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11193-1-ap","provider":"Iright","version":"1.0","type":"link"}