{"product_id":"proteintech-11218-1-ap","title":"Proteintech, 11218-1-AP, TCEAL7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TCEAL7 (11218-1-AP) by Proteintech is a Polyclonal antibody targeting TCEAL7 in WB, IHC, ELISA applications with reactivity to human samples\n11218-1-AP targets TCEAL7 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human liver tissue,  A549 cells\nPositive IHC detected in: human ovary tumor tissue,  human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTCEAL7 is a transcription regulatory factor that has a role in the negative regulation of NF-kappa-B signaling at the basal level by regulating transcriptional activity of NF-kappa-B on its target gene promoters. It can associate with cyclin D1 promoter containing Myc E-box sequence and transcriptionally represses cyclin D1 expression. In addition, TCEAL7 regulates telomerase reverse transcriptase expression and telomerase activity in both ALT (alternative lengthening of telomeres)and telomerase-positive cell lines\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1715 Product name: Recombinant human TCEAL7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC016786 Sequence: MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI Predict reactive species\nFull Name: transcription elongation factor A (SII)-like 7\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC016786\nGene Symbol: TCEAL7\nGene ID (NCBI): 56849\nRRID: AB_2201131\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BRU2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869612003497,"sku":"11218-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11218-1-ap","provider":"Iright","version":"1.0","type":"link"}