{"product_id":"proteintech-11243-1-ap","title":"Proteintech, 11243-1-AP, ARHGEF18 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARHGEF18 (11243-1-AP) by Proteintech is a Polyclonal antibody targeting ARHGEF18 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n11243-1-AP targets ARHGEF18 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue\nPositive IHC detected in: mouse kidney tissue, human kidney tissue,  human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1749 Product name: Recombinant human ARHGEF18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC014994 Sequence: MSQGMQRMHLETLQQVDKWPLCGPLACSELLQLTVRSLEGWRKEVLGSIKGAGTSQGGEIHPRSSSGGERAHVKPCSAPQALVVGLGPG Predict reactive species\nFull Name: rho\/rac guanine nucleotide exchange factor (GEF) 18\nCalculated Molecular Weight: 131 kDa\nObserved Molecular Weight: 120-130 kDa\nGenBank Accession Number: BC014994\nGene Symbol: ARHGEF18\nGene ID (NCBI): 23370\nRRID: AB_2877753\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6ZSZ5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885033607337,"sku":"11243-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11243-1-ap","provider":"Iright","version":"1.0","type":"link"}