{"product_id":"proteintech-11252-2-ap","title":"Proteintech, 11252-2-AP, PMM1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PMM1 (11252-2-AP) by Proteintech is a Polyclonal antibody targeting PMM1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11252-2-AP targets PMM1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human brain tissue,  HepG2 cells,  NIH\/3T3 cells\nPositive IHC detected in: human liver cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPMM1, also named as PMMH22, belongs to the eukaryotic PMM family. It catalyzes the second step in the conversion of fructose-6P to GDP-mannoseis and is involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions. In addition, PMM1 may be responsible for the degradation of glucose-1,6-bisphosphate in ischemic brain(PMID:18927083).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1782 Product name: Recombinant human PMM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-262 aa of BC016818 Sequence: MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA Predict reactive species\nFull Name: phosphomannomutase 1\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC016818\nGene Symbol: PMM1\nGene ID (NCBI): 5372\nRRID: AB_2166971\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92871\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869731770537,"sku":"11252-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11252-2-ap","provider":"Iright","version":"1.0","type":"link"}