{"product_id":"proteintech-11262-2-ap","title":"Proteintech, 11262-2-AP, ATG3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATG3 (11262-2-AP) by Proteintech is a Polyclonal antibody targeting ATG3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11262-2-AP targets ATG3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, HeLa cells,  Jurkat cells,  K-562 cells,  THP-1 cells,  PC-12 cells\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAutophagy is a lysosome-dependent conserved catabolic process in response to various stresses, such as oxidative stress and ischemia, for the degradation and recycling of aged or dysfunctional intracellular components and damaged organelles. A large group of autophagy-related genes (ATGs) have been identifed as essential drivers in diferent stages of autophagy. Autophagy-related 3 (ATG3), one of the autophagyrelated gene family members, serves as an E2-like enzyme contributing to the conjugation of microtubule-associated protein light chain 3 (LC3) to lipid phosphotidylethanolamine (PE). ATG3 plays a signifcant role in the regulation of autophagy, viability, and death.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1785 Product name: Recombinant human ATG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-314 aa of BC024221 Sequence: MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM Predict reactive species\nFull Name: ATG3 autophagy related 3 homolog (S. cerevisiae)\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 36-40 kDa\nGenBank Accession Number: BC024221\nGene Symbol: ATG3\nGene ID (NCBI): 64422\nRRID: AB_2059234\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NT62\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868859912361,"sku":"11262-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11262-2-ap","provider":"Iright","version":"1.0","type":"link"}