{"product_id":"proteintech-11309-1-ap","title":"Proteintech, 11309-1-AP, EIF5A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF5A (11309-1-AP) by Proteintech is a Polyclonal antibody targeting EIF5A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11309-1-AP targets EIF5A in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, NIH\/3T3 cells,  PC-3 cells,  SH-SY5Y cells,  mouse brain tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTranslation of messenger RNA (mRNA) to protein in eukaryotesis a crucial process in protein biosynthesis, in which initiation of translation involves interaction of different eukaryotic translation initiation factors (eIFs), ribosome subunits and mRNAs. Eukaryotic translation initiation factor 5A (EIF5A) is one of the eIFs involved in translation initiation. EIF5A has a essential role in cell viability and the only protein known to contain the amino acid residue hypusine, formed by post-translational modification of a specific lysine residue. Firstly identified as a translation initiation factor, it also has a function in the elongation step of translation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1849 Product name: Recombinant human EIF5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-154 aa of BC001832 Sequence: MADDLDFETGDAGASATFPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDFQLIGIQDGYLSLLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIKAMAK Predict reactive species\nFull Name: eukaryotic translation initiation factor 5A\nCalculated Molecular Weight: 18 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC001832\nGene Symbol: EIF5A\nGene ID (NCBI): 1984\nRRID: AB_2262001\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P63241\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868940619945,"sku":"11309-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11309-1-ap","provider":"Iright","version":"1.0","type":"link"}