{"product_id":"proteintech-11328-1-ap","title":"Proteintech, 11328-1-AP, Integrin Beta 7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Integrin Beta 7 (11328-1-AP) by Proteintech is a Polyclonal antibody targeting Integrin Beta 7 in WB, IHC, ELISA applications with reactivity to human samples\n11328-1-AP targets Integrin Beta 7 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, human lung tissue,  K-562 cells\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nITGB7 (integrin, beta7) is a single-pass type I membrane protein that belongs to the integrin beta chain family. The integrins are a large family of cell-surface glycoprotein receptors that play key roles in leucocyte adhesion, signalling, proliferation and migration by binding as heterodimers to specific ligands. The beta7 integrin associates with alpha4 integrin to form a heterodimer, alpha4\/beta7, which interacts with MADCAM1, VCAM, fibronectin, and may also interact with HIV-1 gp120. The beta7 integrin can also form a heterodimer with alphaE integrin, and the dimer, alphaE\/beta7 integrin, is a receptor for E-cadherin. ITGB7 is expressed in a variety of leukocyte lines.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1871 Product name: Recombinant human Integrin beta-7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 499-798 aa of BC015916 Sequence: VCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGKGHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSGDMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTGPLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKGADHTQAIVLGCVGGIVAVGLGLVLAYRLSVEIYDRREYSRFEKEQQQLNWKQDSNPLYKSAITTTINPRFQEADSPTL Predict reactive species\nFull Name: integrin, beta 7\nCalculated Molecular Weight: 798 aa, 87 kDa\nObserved Molecular Weight: 87-100 kDa\nGenBank Accession Number: BC015916\nGene Symbol: Integrin beta 7\nGene ID (NCBI): 3695\nRRID: AB_2249380\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P26010\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868983185577,"sku":"11328-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11328-1-ap","provider":"Iright","version":"1.0","type":"link"}