{"product_id":"proteintech-11330-1-ap","title":"Proteintech, 11330-1-AP, DNASE1L3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNASE1L3 (11330-1-AP) by Proteintech is a Polyclonal antibody targeting DNASE1L3 in WB, ELISA applications with reactivity to human samples\n11330-1-AP targets DNASE1L3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDeoxyribonuclease 1-like 3 (DNASE1L3, DNase gamma, DNase Y, LS-DNase) is member of a DNASE1 protein family that is identified by similar biochemical properties such as Ca2+\/Mg2+ dependency and an optimal pH of about 7.0 as well as by a high similarity in their nucleic acid and amino acid sequences [PMID:15796714]. It is an endonuclease and cleaves double-stranded DNA (and single-stranded DNA) producing 3'-OH\/5'-P ends, which is Ca2+\/Mg2+-dependent and inhibited by Zn2+, but not by monomeric actin [PMID:9665719]. In addition, it has been suggested to be involved in apoptotic DNA fragmentation of thymocytes neuronal PC12 cells, C2C12 myoblasts and of cell lines expressing the recombinant nuclease [PMID: 7957253, 9307016]\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1873 Product name: Recombinant human DNASE1L3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-305 aa of BC015831 Sequence: MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS Predict reactive species\nFull Name: deoxyribonuclease I-like 3\nCalculated Molecular Weight: 305 aa, 36 kDa\nObserved Molecular Weight: 33-38 kDa\nGenBank Accession Number: BC015831\nGene Symbol: DNASE1L3\nGene ID (NCBI): 1776\nRRID: AB_2095527\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13609\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887271334057,"sku":"11330-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11330-1-ap","provider":"Iright","version":"1.0","type":"link"}