{"product_id":"proteintech-11334-1-ap","title":"Proteintech, 11334-1-AP, PTPN1\/PTP1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTPN1\/PTP1B (11334-1-AP) by Proteintech is a Polyclonal antibody targeting PTPN1\/PTP1B in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11334-1-AP targets PTPN1\/PTP1B in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Sp2\/0 cells, HeLa cells,  mouse liver tissue,  THP-1 cells,  Jurkat cells,  C6 cells,  NIH\/3T3 cells,  rat liver tissue,  mouse placenta tissue\nPositive IP detected in: A431 cells\nPositive IHC detected in: mouse placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: BxPC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTPN1 (protein tyrosine phosphatase, non-receptor type 1) is also named as PTP1B or PTP-1B, and belongs to the protein-tyrosine phosphatase family and non-receptor class 1 subfamily. PTPN1 is involved in the regulation of several important physiological pathways, which regulates both INS and leptin signaling, and interacts with the epidermal-and platelet-derived growth factor receptors (PMID: 20101100). The gene might harbor variants influencing susceptibility to INS resistance and type 2 diabetes (PMID:15919813). The molecular mass of PTPN1 is 50 kDa, but sometimes some truncated forms can be detected as 48, 46, 39, 37 kDa due to non-specific proteolytic cleavage of PTP1B in different cells (PMID: 18253097).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1878 Product name: Recombinant human PTPN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-435 aa of BC015660 Sequence: MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT Predict reactive species\nFull Name: protein tyrosine phosphatase, non-receptor type 1\nCalculated Molecular Weight: 435 aa, 50 kDa\nObserved Molecular Weight: 45-55 kDa\nGenBank Accession Number: BC015660\nGene Symbol: PTP1B\nGene ID (NCBI): 5770\nRRID: AB_10642566\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P18031\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868848279721,"sku":"11334-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11334-1-ap","provider":"Iright","version":"1.0","type":"link"}