{"product_id":"proteintech-11339-1-ap","title":"Proteintech, 11339-1-AP, PSMC3IP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMC3IP (11339-1-AP) by Proteintech is a Polyclonal antibody targeting PSMC3IP in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11339-1-AP targets PSMC3IP in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, K-562 cells,  Jurkat cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMC3IP, also called HOP2, encodes a protein that functions in meiotic recombination. It is a subunit of the PSMC3IP\/MND1 complex, which interacts with PSMC3\/TBP1 to stimulate DMC1- and RAD51-mediated strand exchange during meiosis. The protein encoded by this gene can also co-activate ligand-driven transcription mediated by estrogen, androgen, glucocorticoid, progesterone, and thyroid nuclear receptors. Mutations in this gene cause XX female gonadal dysgenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1883 Product name: Recombinant human PSMC3IP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC008792 Sequence: MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKIYFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAEMQKEIQELKKECAGYRERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPDP Predict reactive species\nFull Name: PSMC3 interacting protein\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 24-29 kDa\nGenBank Accession Number: BC008792\nGene Symbol: PSMC3IP\nGene ID (NCBI): 29893\nRRID: AB_2172642\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P2W1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869007859881,"sku":"11339-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11339-1-ap","provider":"Iright","version":"1.0","type":"link"}