{"product_id":"proteintech-11341-1-ap","title":"Proteintech, 11341-1-AP, ZBTB7B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZBTB7B (11341-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB7B in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11341-1-AP targets ZBTB7B in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:800-1:3200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZBTB7B belongs to a large family of transcription factors, generally acting as repressors, characterized by a carboxy-terminal DNA binding domain made of multiple zinc fingers (four in Thpok) and an amino-terminal BTB-POZ domain that mediates homo- (and possibly hetero-) dimerization [PMID: 17084908]. Zbtb7b is up-regulated by MHC-II-restricted thymocytes during their CD4 differentiation and is a major determinant of CD4 lineage choice. Two properties of ZBTB7B deserve attention. First, although Thpok is expressed in a wide variety of cells, its expression in the thymus is highly lineage-specific : CD4 SP thymocytes (and all CD4 T cells) express Thpok, whereas DP and CD8 SP thymocytes do notSecond, both loss- and gain-of-function experiments indicate that Thpok affects lineage choice but not positive selection [PMID: 15729333, 10550051].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, bovine, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1888 Product name: Recombinant human ZBTB7B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC012070 Sequence: MGSPEDDLIGIPFPDHSSELLSCLNEQRQLGHLCDLTIRTQGLEYRTHRAVLAACSHYFKKLFTEGGGGAVMGAGGSGTATGGAGAGVCELDFVGPEALGALLEFAYTATLTTSSANMPAVLQAARLLEIPCVIAACMEILQGSGLEAPSPDEDDCERARQYLEAFATATASGVPNGEDSPPQVPLPPPPPPPPRPVARRSRKPRKAFLQTKGARANHLVPEVPTVPAHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSP Predict reactive species\nFull Name: zinc finger and BTB domain containing 7B\nCalculated Molecular Weight: 539 aa, 58 kDa\nObserved Molecular Weight: 60-65 kDa\nGenBank Accession Number: BC012070\nGene Symbol: ZBTB7B\nGene ID (NCBI): 51043\nRRID: AB_2217245\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15156\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869390885033,"sku":"11341-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11341-1-ap","provider":"Iright","version":"1.0","type":"link"}