{"product_id":"proteintech-11357-1-ap","title":"Proteintech, 11357-1-AP, DDX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDX1 (11357-1-AP) by Proteintech is a Polyclonal antibody targeting DDX1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11357-1-AP targets DDX1 in WB, IHC, IF\/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, A431 cells,  HeLa cells,  MCF-7 cells,  NCI-H1299 cells,  NIH\/3T3 cells,  mouse brain tissue,  rat brain tissue,  PC-3 cells,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: human stomach tissue, human lymphoma tissue,  human ovary tumor tissue,  mouse brain tissue,  mouse lung tissue,  mouse skin tissue,  rat brain tissue,  rat lung tissue,  rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDX1 is a DEAD box protein, which is putative RNA helicases with a characteristic asp-glu-ala-asp (DEAD) box motif. DEAD box proteins involve in translation initiation, splicing, and ribosome and spliceosome assembly by altering RNA secondary structure. As a RNA helicase, DDX1 has a role in RNA clearance at DNA double-strand breaks (DSBs), thereby facilitating the template-guided repair of transcriptionally active regions of the genome.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1887 Product name: Recombinant human DDX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 391-740 aa of BC012132 Sequence: IPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 1\nCalculated Molecular Weight: 740 aa, 82 kDa\nObserved Molecular Weight: 70-82 kDa\nGenBank Accession Number: BC012132\nGene Symbol: DDX1\nGene ID (NCBI): 1653\nRRID: AB_2092222\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92499\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868867612841,"sku":"11357-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11357-1-ap","provider":"Iright","version":"1.0","type":"link"}