{"product_id":"proteintech-11382-2-ap","title":"Proteintech, 11382-2-AP, EHD4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EHD4 (11382-2-AP) by Proteintech is a Polyclonal antibody targeting EHD4 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11382-2-AP targets EHD4 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, mouse testis tissue,  HeLa cells,  HEK-293T cells,  HepG2 cells,  mouse heart tissue,  rat heart tissue\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nH-domain containing 4, also known as EHD4, belongs to the EHD protein family. Northern blot analysis detected expression of 4 mRNA species of approximately 2.0, 2.7, 3.2, and 3.6 kb. All of the transcripts are highly expressed in pancreas, and the 2.7- and 3.6-kb transcripts are highly expressed in heart. Only weak expression is found in other tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1942 Product name: Recombinant human EHD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 335-541 aa of BC006287 Sequence: ISRLPEIYIQLQREYQISAGDFPEVKAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLPNSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRKSLPKAD Predict reactive species\nFull Name: EH-domain containing 4\nCalculated Molecular Weight: 541 aa, 61 kDa\nObserved Molecular Weight: 61 kDa\nGenBank Accession Number: BC006287\nGene Symbol: EHD4\nGene ID (NCBI): 30844\nRRID: AB_2277764\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H223\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868997111977,"sku":"11382-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11382-2-ap","provider":"Iright","version":"1.0","type":"link"}