{"product_id":"proteintech-11402-1-ap","title":"Proteintech, 11402-1-AP, EEF1A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EEF1A1 (11402-1-AP) by Proteintech is a Polyclonal antibody targeting EEF1A1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11402-1-AP targets EEF1A1 in WB, IHC, IF\/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  mouse liver tissue,  mouse skeletal muscle tissue,  MCF-7 cells,  mouse pancreas tissue,  mouse ovary tissue,  mouse heart tissue,  rat brain tissue,  human brain tissue,  Jurkat cells,  SH-SY5Y cells,  Neuro-2a cells,  C2C12 cells,  HepG2 cells,  mouse brain tissue\nPositive IHC detected in: mouse brain tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEEF1A1, also named as EEF1A, EF1A  and LENG7, belongs to the GTP-binding elongation factor family. This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.\nIt is a typical housekeeping gene product required for the maintenance of cell growth and\/or survival. In addition, EEF1A1 protects the aminoester bond against hydrolysis until a correct match between the codon on mRNA and the anti-codon on tRNA can be achieved. This antibody is a rabbit polyclonal antibody raised against residues near the C terminus of human EEF1A1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1938 Product name: Recombinant human EEF1A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 144-462 aa of BC014224 Sequence: GVKQLIVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPDTVAFVPISGWNGDNMLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKAVDKKAAGAGKVTKSAQKAQKAK Predict reactive species\nFull Name: eukaryotic translation elongation factor 1 alpha 1\nCalculated Molecular Weight: 462 aa, 50 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC014224\nGene Symbol: EEF1A1\nGene ID (NCBI): 1915\nRRID: AB_2096966\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P68104\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868858831017,"sku":"11402-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11402-1-ap","provider":"Iright","version":"1.0","type":"link"}