{"product_id":"proteintech-11411-2-ap","title":"Proteintech, 11411-2-AP, COX7C Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COX7C (11411-2-AP) by Proteintech is a Polyclonal antibody targeting COX7C in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11411-2-AP targets COX7C in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse ovary tissue,  human skeletal muscle tissue\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. COX7C (Cytochrome c oxidase subunit 7C, mitochondrial) is one of the subunits, catalyzing the elctron transfer from reduced cytochrome c to molecule oxygen. This protein belongs to the cytochrome c oxidase VIIc family. The calculated molecular weight of COX7C is 7 kDa, but due to the presence of the complex, a complex form of 28 kDa may also be observed.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1989 Product name: Recombinant human COX7C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC007498 Sequence: MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT Predict reactive species\nFull Name: cytochrome c oxidase subunit VIIc\nCalculated Molecular Weight: 63 aa, 7 kDa\nObserved Molecular Weight: 15~28 kDa\nGenBank Accession Number: BC007498\nGene Symbol: COX7C\nGene ID (NCBI): 1350\nRRID: AB_2085713\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15954\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868978598057,"sku":"11411-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11411-2-ap","provider":"Iright","version":"1.0","type":"link"}