{"product_id":"proteintech-11416-1-ap","title":"Proteintech, 11416-1-AP, COX7A2L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COX7A2L (11416-1-AP) by Proteintech is a Polyclonal antibody targeting COX7A2L in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11416-1-AP targets COX7A2L in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: human ovary tumor tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCytochrome c oxidase (COX) is the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. The mitochondrially encoded subunits function in electron transfer, and the nuclear encoded subunits may function in the regulation and assembly of the complex. COX7A2L (cytochrome c oxidase subunit 7A-related protein), also known as COX7AR or COX7RP, is an inner mitochondrial membrane protein. This gene is expressed in all tissues, and upregulated in a breast cancer cell line after estrogen treatment. Recently it was found that DNA methylation of COX7A2L had a significant association with therapy response in patients with breast cancer. In Alzheimer's disease the expression of COX7A2L was reduced.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1980 Product name: Recombinant human COX7A2L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC007095 Sequence: MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKVPELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK Predict reactive species\nFull Name: cytochrome c oxidase subunit VIIa polypeptide 2 like\nCalculated Molecular Weight: 114 aa, 13 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC007095\nGene Symbol: COX7A2L\nGene ID (NCBI): 9167\nRRID: AB_2245402\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14548\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868876034217,"sku":"11416-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11416-1-ap","provider":"Iright","version":"1.0","type":"link"}