{"product_id":"proteintech-11421-1-ap","title":"Proteintech, 11421-1-AP, COX6A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COX6A2 (11421-1-AP) by Proteintech is a Polyclonal antibody targeting COX6A2 in IF-P, ELISA applications with reactivity to human samples\n11421-1-AP targets COX6A2 in WB, IF-P, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF-P detected in: human heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOX6A2(Cytochrome c oxidase subunit 6A2, mitochondrial) is also named as COX6A, COX6AH and Belongs to the cytochrome c oxidase subunit 6A family. This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1985 Product name: Recombinant human COX6A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC029818 Sequence: MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP Predict reactive species\nFull Name: cytochrome c oxidase subunit VIa polypeptide 2\nCalculated Molecular Weight: 97 aa, 11 kDa\nGenBank Accession Number: BC029818\nGene Symbol: COX6A2\nGene ID (NCBI): 1339\nRRID: AB_11232029\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q02221\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869453996201,"sku":"11421-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11421-1-ap","provider":"Iright","version":"1.0","type":"link"}