{"product_id":"proteintech-11445-1-ap","title":"Proteintech, 11445-1-AP, RAB24 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB24 (11445-1-AP) by Proteintech is a Polyclonal antibody targeting RAB24 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11445-1-AP targets RAB24 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, human skeletal muscle tissue,  mouse brain tissue,  fetal human brain tissue,  mouse cerebellum tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human gliomas tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRAB24 is a small GTPase of the Rab subfamily of Ras-related proteins that regulate intracellular protein trafficking. Unlike other Rab family members, RAB24 does not interact with GDP dissociation inhibitors (GDIs), including ARHGDIA and ARHGDIB. It Interacts with ZFYVE20. Rab24 modulates several mitotic events, including chromosome segregation and cytokinesis, perhaps through the interaction with microtubules.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1995 Product name: Recombinant human RAB24 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-203 aa of BC021263 Sequence: MSGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAKVMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSCCHH Predict reactive species\nFull Name: RAB24, member RAS oncogene family\nCalculated Molecular Weight: 203 aa, 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC021263\nGene Symbol: RAB24\nGene ID (NCBI): 53917\nRRID: AB_2269046\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q969Q5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869579104425,"sku":"11445-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11445-1-ap","provider":"Iright","version":"1.0","type":"link"}