{"product_id":"proteintech-11454-1-ap","title":"Proteintech, 11454-1-AP, MZB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MZB1 (11454-1-AP) by Proteintech is a Polyclonal antibody targeting MZB1 in WB, IHC, ELISA applications with reactivity to human samples\n11454-1-AP targets MZB1 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells\nPositive IHC detected in: human gliomas tissue,  human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMZB1, also named as ,PACAP, MGC29506 and pERp1, belongs to the PERP1 family.  It is associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. MGC29506(PACAP) may exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity. Isoform 2 may be involved in regulation of apoptosis. (PubMed: 11350957) MZB1 has 5 isoforms with MW 21kd and 7-13kd.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2015 Product name: Recombinant human MZB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-189 aa of BC021275 Sequence: MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL Predict reactive species\nFull Name: hypothetical protein MGC29506\nCalculated Molecular Weight: 189 aa, 21 kDa\nObserved Molecular Weight: 19-21 kDa\nGenBank Accession Number: BC021275\nGene Symbol: MZB1\nGene ID (NCBI): 51237\nRRID: AB_832820\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WU39\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868970635433,"sku":"11454-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11454-1-ap","provider":"Iright","version":"1.0","type":"link"}