{"product_id":"proteintech-11456-1-ap","title":"Proteintech, 11456-1-AP, S100A16 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe S100A16 (11456-1-AP) by Proteintech is a Polyclonal antibody targeting S100A16 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n11456-1-AP targets S100A16 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, DU 145 cells,  MCF-7 cells\nPositive IHC detected in: human lung cancer tissue, human bowen disease,  human colon cancer tissue,  mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS100A16 is a member of the S100 protein family. S100A16 is expressed in a variety of human tissues. S100A16 expression is especially high in tissues rich in epithelial cells. Functionally, S100A16 has been linked to several aspects of tumorigenesis, for example, cell proliferation, differentiation, migration, invasion, and epithelial-mesenchymal transition (EMT).Accordingly, S100A16 has been suggested to have both tumour-promoting and suppressive roles in human cancers. S100A16-mediated cellular functions are suggested to be mediated by the regulation of various signaling pathways\/proteins including EMT-related proteins E-cadherin and Vimentin, PI3K-AKT, p53, MMP1-1, MMP-2, MMP-9, JNK\/p38, etc. (PMID: 37509106).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2023 Product name: Recombinant human S100A16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC019099 Sequence: MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS Predict reactive species\nFull Name: S100 calcium binding protein A16\nCalculated Molecular Weight: 103 aa, 12 kDa\nObserved Molecular Weight: 9-12 kDa\nGenBank Accession Number: BC019099\nGene Symbol: S100A16\nGene ID (NCBI): 140576\nRRID: AB_2269940\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96FQ6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868899201193,"sku":"11456-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11456-1-ap","provider":"Iright","version":"1.0","type":"link"}