{"product_id":"proteintech-11464-1-ap","title":"Proteintech, 11464-1-AP, COX17 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COX17 (11464-1-AP) by Proteintech is a Polyclonal antibody targeting COX17 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11464-1-AP targets COX17 in WB, IHC, IF\/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, rat heart tissue,  THP-1 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2032 Product name: Recombinant human COX17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC010933 Sequence: MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI Predict reactive species\nFull Name: COX17 cytochrome c oxidase assembly homolog (S. cerevisiae)\nCalculated Molecular Weight: 63 aa, 7 kDa\nObserved Molecular Weight: 7 kDa\nGenBank Accession Number: BC010933\nGene Symbol: COX17\nGene ID (NCBI): 10063\nRRID: AB_2085109\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14061\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868878622889,"sku":"11464-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11464-1-ap","provider":"Iright","version":"1.0","type":"link"}