{"product_id":"proteintech-11469-1-ap","title":"Proteintech, 11469-1-AP, PSMD5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMD5 (11469-1-AP) by Proteintech is a Polyclonal antibody targeting PSMD5 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11469-1-AP targets PSMD5 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  human liver tissue,  mouse liver tissue\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMD5, also named as KIAA0072, belongs to the proteasome subunit S5B\/HSM3 family. It acts as a chaperone during the assembly of the 26S proteasome, specifically of the base subcomplex of the PA700\/19S regulatory complex (RC). In the initial step of the base subcomplex assembly, it is part of an intermediate PSMD5:PSMC2:PSMC1:PSMD2 module which probably assembles with a SMD10:PSMC4:PSMC5:PAAF1 module followed by dissociation of PSMD5. (PMID:15489334). This antibody is specific to PSMD5.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2026 Product name: Recombinant human PSMD5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 154-504 aa of BC014478 Sequence: LTQAGLEALFESNLLDDLKSVMKTNDIVRYRVYELIIEISSVSPESLNYCTTSGLVTQLLRELTGEDVLVRATCIEMVTSLAYTHHGRQYLAQEGVIDQISNIIVGADSDPFSSFYLPGFVKFFGNLAVMDSPQQICERYPIFVEKVFEMIESQDPTMIGVAVDTVGILGSNVEGKQVLQKTGTRFERLLMRIGHQSKNAPVELKIRCLDAISSLLYLPPEQQTDDLLRMTESWFSSLSRDPLELFRGISSQPFPELHCAALKVFTAIANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPYYVKPVSTTAVEGAE Predict reactive species\nFull Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 5\nCalculated Molecular Weight: 504 aa, 56 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC014478\nGene Symbol: PSMD5\nGene ID (NCBI): 5711\nRRID: AB_2170648\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16401\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887776288937,"sku":"11469-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11469-1-ap","provider":"Iright","version":"1.0","type":"link"}