{"product_id":"proteintech-11487-1-ap","title":"Proteintech, 11487-1-AP, HECTD3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HECTD3 (11487-1-AP) by Proteintech is a Polyclonal antibody targeting HECTD3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n11487-1-AP targets HECTD3 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, MDA-MB-453s cells\nPositive IP detected in: MDA-MB-453s cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHECTD3(HECT domain-containing protein 3) may be involved in the regulation of mitotic metaphase\/anaphase transition. It can specifically ubiquitinate TRIOBP and target it for proteasomal degradation and it can also mediates the ubiquitination of STX8. HECTD3 is a new oncogenic E3 ligase in human prostate cancer.( Li Y, etc. 2008) HECTD3 may facilitate cell cycle progression via regulating ubiquitination and degradation of Tara(PMID:18194665). It has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1998 Product name: Recombinant human HECTD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-213 aa of BC019105 Sequence: VMEGMDKETFEFKFGKELTFTTVLSDQQVVELIPGGAGIVVGYGDRSRFIQLVQKARLEESKEQVAAMQAGLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDSRVQYFWEALNNFTNEDRSRFLRFVTGRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEEKLRYAAYNCVAIDTDMSPWEE Predict reactive species\nFull Name: HECT domain containing 3\nCalculated Molecular Weight: 861 aa, 97 kDa\nObserved Molecular Weight: 97 kDa\nGenBank Accession Number: BC019105\nGene Symbol: HECTD3\nGene ID (NCBI): 79654\nRRID: AB_2117517\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5T447\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868955463849,"sku":"11487-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11487-1-ap","provider":"Iright","version":"1.0","type":"link"}