{"product_id":"proteintech-11492-1-ap","title":"Proteintech, 11492-1-AP, PPFIA3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPFIA3 (11492-1-AP) by Proteintech is a Polyclonal antibody targeting PPFIA3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11492-1-AP targets PPFIA3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HEK-293 cells,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPFIA3, also named as KIAA0654, belongs to the liprin family and Liprin-alpha subfamily. PPFIA3 may regulate the disassembly of focal adhesions. It may localize receptor-like tyrosine phosphatases type 2A at specific sites on the plasma membrane, possibly regulating their interaction with the extracellular environment and their association with substrates. PPFIA3 exhibites more than 5 fold accumulations in the monoribosome fraction. PPFIA3 is decreased at the protein level by the miR-99 family but not in the luciferase reporter with the 3'UTR of PPFIA3. (PMID:21212412)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag1971 Product name: Recombinant human PPFIA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-277 aa of BC021255 Sequence: APASSRTSTGNVWMTHEEMESLTATTKPILAYGDMNHEWVGNDWLPSLGLPQYRSYFMESLVDARMLDHLNKKELRGQLKMVDSFHRVSLHYGIMCLKRLNYDRKDLERRREESQTQIRDVMVWSNERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDLRGVTPDSAEMLPPNFRSAAAGALGSPGLPLRKLQPEGQTSGSSRADGVSVRTYSC Predict reactive species\nFull Name: protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3\nCalculated Molecular Weight: 1194 aa, 133 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: BC021255\nGene Symbol: PPFIA3\nGene ID (NCBI): 8541\nRRID: AB_2171628\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75145\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869489123497,"sku":"11492-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11492-1-ap","provider":"Iright","version":"1.0","type":"link"}