{"product_id":"proteintech-11499-1-ap","title":"Proteintech, 11499-1-AP, FBXW2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXW2 (11499-1-AP) by Proteintech is a Polyclonal antibody targeting FBXW2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11499-1-AP targets FBXW2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, mouse kidney tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe human FBW2 polypeptide contains an N-terminal F-box motif and a C-terminal domain of five WD repeats. A WD repeat is a motif typically consisting of 44-60 amino acids with a signature tryptophan and aspartic acid dipeptide at its C-terminus. The WD repeats in FBW2 recognize GCM1 in a way that is facilitated by GSK3b. Two isoforms were produced by alternative splicing with predicted MW of 52 and 43 kDa according to UniProt, and Catalog#11499-1-AP can recognise both.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2045 Product name: Recombinant human FBXW2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-314 aa of BC018738 Sequence: MERKDFETWLDNISVTFLSLTDLQKNETLDHLISLSGAVQLRHLSNNLETLLKRDFLKLLPLELSFYLLKWLDPQTLLTCCLVSKQWNKVISACTEVWQTACKNLGWQIDDSVQDALHWKKVYLKAILRMKQLEDHEAFETSSLIGHSARVYALYYKDGLLCTGSDDLSAKLWDVSTGQCVYGIQTHTCAAVKFDEQKLVTGSFDNTVACWEWSSGARTQHFRGHTGAVFSVDYNDELDILVSGSADFTVKVWALSAGTCLNTLTGHTEWVTKVVLQKCKVKSLLHSPGDYILLSADKYEIKIWPIGREINCKC Predict reactive species\nFull Name: F-box and WD repeat domain containing 2\nCalculated Molecular Weight: 44 kDa, 52 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC018738\nGene Symbol: FBXW2\nGene ID (NCBI): 26190\nRRID: AB_2102740\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UKT8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868954808489,"sku":"11499-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11499-1-ap","provider":"Iright","version":"1.0","type":"link"}