{"product_id":"proteintech-11509-1-ap","title":"Proteintech, 11509-1-AP, CNN3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CNN3 (11509-1-AP) by Proteintech is a Polyclonal antibody targeting CNN3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11509-1-AP targets CNN3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HAP1 cells,  human kidney tissue,  human skeletal muscle tissue,  HEK-293 cells,  HepG2 cells,  NIH\/3T3 cells\nPositive IP detected in: HEK-293 cells, U-87MG cells\nPositive IHC detected in: human prostate cancer tissue, human hysteromyoma tissue,  human skin tissue,  human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). Calponin 1 and calponin 2 are predominately expressed in smooth muscle cells and cardiac muscle cells, respectively. Calponin 3 is highly expressed in many tissues including articular cartilage and brain. CNN3 is the thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2068 Product name: Recombinant human CNN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-329 aa of BC025372 Sequence: MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY Predict reactive species\nFull Name: calponin 3, acidic\nCalculated Molecular Weight: 329 aa, 36 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC025372\nGene Symbol: CNN3\nGene ID (NCBI): 1266\nRRID: AB_2082140\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15417\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868995670185,"sku":"11509-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11509-1-ap","provider":"Iright","version":"1.0","type":"link"}