{"product_id":"proteintech-11573-1-ap","title":"Proteintech, 11573-1-AP, PSMA6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PSMA6 (11573-1-AP) by Proteintech is a Polyclonal antibody targeting PSMA6 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n11573-1-AP targets PSMA6 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HEK-293 cells,  HepG2 cells,  Jurkat cells,  MCF-7 cells,  Neuro-2a cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human thyroid cancer tissue, human lung cancer tissue,  human testis tissue,  mouse brain tissue,  mouse colon tissue,  mouse testis tissue,  rat small intestine tissue,  rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, MCF-7 cells,  HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPSMA6(Proteasome subunit alpha type-6) is also named as PROS27 and belongs to the peptidase T1A family.The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH.It also has an ATP-dependent proteolytic activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, oyster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2154 Product name: Recombinant human PSMA6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-246 aa of BC023659 Sequence: MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD Predict reactive species\nFull Name: proteasome (prosome, macropain) subunit, alpha type, 6\nCalculated Molecular Weight: 246 aa, 27 kDa\nObserved Molecular Weight: 27-29 kDa\nGenBank Accession Number: BC023659\nGene Symbol: PSMA6\nGene ID (NCBI): 5687\nRRID: AB_2171742\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P60900\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869425094825,"sku":"11573-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11573-1-ap","provider":"Iright","version":"1.0","type":"link"}