{"product_id":"proteintech-11588-1-ap","title":"Proteintech, 11588-1-AP, RABL2B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RABL2B (11588-1-AP) by Proteintech is a Polyclonal antibody targeting RABL2B in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n11588-1-AP targets RABL2B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, HepG2 cells,  human brain tissue,  human heart tissue,  human kidney tissue,  human liver tissue,  mouse brain tissue\nPositive IP detected in: fetal human brain tissue\nPositive IHC detected in: mouse kidney tissue, human lung cancer tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRab-like protein 2B (RABL2B) is a member of a poorly characterised clade of the RAS GTPase superfamily, which plays an essential role in male fertility, sperm intraflagellar transport and tail assembly (PMID: 28553998, PMID: 28138870). A preferential expression of RABL2B in human tissues and lymphoblastoid cell lines was detected which is most pronounced in brain and placenta (PMID: 20138207).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2189 Product name: Recombinant human RABL2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-229 aa of BC024281 Sequence: MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYKHTATVDGRTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELREFRPEIPCIVVANKIDADINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSYKQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEAASPHS Predict reactive species\nFull Name: RAB, member of RAS oncogene family-like 2B\nCalculated Molecular Weight: 229 aa, 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC024281\nGene Symbol: RABL2B\nGene ID (NCBI): 11158\nRRID: AB_2175954\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UNT1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869579792553,"sku":"11588-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11588-1-ap","provider":"Iright","version":"1.0","type":"link"}