{"product_id":"proteintech-11590-1-ap","title":"Proteintech, 11590-1-AP, RGS5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RGS5 (11590-1-AP) by Proteintech is a Polyclonal antibody targeting RGS5 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n11590-1-AP targets RGS5 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, human heart tissue,  human skeletal muscle tissue,  mouse heart tissue,  MCF-7 cells,  rat skeletal muscle tissue\nPositive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRGS5 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. It binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha. The 42kd band recognized by this antibody is a RGS5-RGS5 dimer. (Pubmed:17762159)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2196 Product name: Recombinant human RGS5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC030059 Sequence: MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK Predict reactive species\nFull Name: regulator of G-protein signaling 5\nCalculated Molecular Weight: 181 aa, 21 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC030059\nGene Symbol: RGS5\nGene ID (NCBI): 8490\nRRID: AB_10644290\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15539\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868894810281,"sku":"11590-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11590-1-ap","provider":"Iright","version":"1.0","type":"link"}