{"product_id":"proteintech-11597-1-ap","title":"Proteintech, 11597-1-AP, IFI30 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFI30 (11597-1-AP) by Proteintech is a Polyclonal antibody targeting IFI30 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n11597-1-AP targets IFI30 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells\nPositive IP detected in: COLO 320 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIFI30(interferon, gamma-inducible protein 30) is also named as IP30, GILT, IFI-30, MGC32056, IFI30 and belongs to the GILT family. It can facilitate the processing and presentation to antigen-specific T cells of protein antigens containing disulfide bonds. IFI30 is inducibly up-regulated by IFN-g, as are MHC class II molecules, the associated invariant chain, and HLA-DM, which catalyses peptide loading in MIICs and the 35 kDa species is the IFI30 proform, and the 30-kDa species is the mature form(PMID:10639150). It can exsit as a dimer(PMID:17142755).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2178 Product name: Recombinant human IFI30 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-260 aa of BC021136 Sequence: CSRHTFAPAAMTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK Predict reactive species\nFull Name: interferon, gamma-inducible protein 30\nCalculated Molecular Weight: 261 aa, 29 kDa\nObserved Molecular Weight: 29 kDa\nGenBank Accession Number: BC021136\nGene Symbol: IFI30\nGene ID (NCBI): 10437\nRRID: AB_2121789\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13284\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868968276137,"sku":"11597-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11597-1-ap","provider":"Iright","version":"1.0","type":"link"}