{"product_id":"proteintech-11651-1-ap","title":"Proteintech, 11651-1-AP, PPIH Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPIH (11651-1-AP) by Proteintech is a Polyclonal antibody targeting PPIH in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11651-1-AP targets PPIH in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, K-562 cells,  PC-3 cells,  mouse colon tissue,  rat colon tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPIH(Peptidyl-prolyl cis-trans isomerase H) is also named as CYP20, CYPH and belongs to cyclophilin-type PPIase family, PPIase H subfamily.It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may act as a chaperone(PMID:12875835).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2253 Product name: Recombinant human PPIH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-177 aa of BC003412 Sequence: MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM Predict reactive species\nFull Name: peptidylprolyl isomerase H (cyclophilin H)\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC003412\nGene Symbol: PPIH\nGene ID (NCBI): 10465\nRRID: AB_2284306\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43447\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869733802153,"sku":"11651-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11651-1-ap","provider":"Iright","version":"1.0","type":"link"}