{"product_id":"proteintech-11657-1-ap","title":"Proteintech, 11657-1-AP, INTS9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe INTS9 (11657-1-AP) by Proteintech is a Polyclonal antibody targeting INTS9 in WB, IHC, IP, ELISA applications with reactivity to human samples\n11657-1-AP targets INTS9 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells,  Jurkat cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nINTS9, also known as Integrator Complex Subunit 9, is part of the core cleavage module consisting of INTS4\/INTS9\/INTS11 involved in processing small nuclear RNA (snRNA) molecules. It is a subunit of the Integrator complex, which comprises 15 subunits (including INTS6L), and plays a crucial role in the 3' end processing of snRNAs. By participating in the biogenesis of snRNAs, INTS9 contributes to the proper functioning of the spliceosome, a cellular machinery responsible for the accurate splicing of precursor messenger RNA (pre-mRNA) molecules. This process is essential for generating mature messenger RNA (mRNA), which is subsequently translated into functional proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2226 Product name: Recombinant human INTS9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 309-658 aa of BC025267 Sequence: LECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEPPFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTVIFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF Predict reactive species\nFull Name: integrator complex subunit 9\nCalculated Molecular Weight: 658 aa, 74 kDa\nObserved Molecular Weight: 74 kDa\nGenBank Accession Number: BC025267\nGene Symbol: INTS9\nGene ID (NCBI): 55756\nRRID: AB_2127514\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NV88\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868983218345,"sku":"11657-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11657-1-ap","provider":"Iright","version":"1.0","type":"link"}