{"product_id":"proteintech-11663-1-ap","title":"Proteintech, 11663-1-AP, VDAC1\/2\/3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VDAC1\/2\/3 (11663-1-AP) by Proteintech is a Polyclonal antibody targeting VDAC1\/2\/3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11663-1-AP targets VDAC1\/2\/3 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, human heart tissue,  mouse heart tissue,  rat brain tissue,  rat heart tissue\nPositive IHC detected in: human prostate cancer tissue, human normal colon,  human prostate tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVDACs (Voltage Dependent Anion selective Channels), also known as mitochondrial porins, are a family of pore-forming proteins discovered in the mitochondrial outer membrane. Mammals show a conserved genetic organization of the VDAC genes. It's reported that the amount of VDAC transcripts in liver is usually lower than in the other tissues. VDAC2 and expecially VDAC3 are highly expressed in testis, while mouse VDAC1 is poorly expressed in this tissue.(PMID: 22020053)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, duck\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2266 Product name: Recombinant human VDAC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-294 aa of BC000165 Sequence: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA Predict reactive species\nFull Name: voltage-dependent anion channel 2\nCalculated Molecular Weight: 294 aa, 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC000165\nGene Symbol: VDAC2\nGene ID (NCBI): 7417\nRRID: AB_2304144\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P45880\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868853784745,"sku":"11663-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11663-1-ap","provider":"Iright","version":"1.0","type":"link"}