{"product_id":"proteintech-11666-1-ap","title":"Proteintech, 11666-1-AP, WSB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WSB1 (11666-1-AP) by Proteintech is a Polyclonal antibody targeting WSB1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n11666-1-AP targets WSB1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HepG2 cells,  SMMC-7721 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWSB1 (or SWIP1) gene encodes WD repeat and SOCS box-containing protein 1, a member of the WD-protein subfamily. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding 3 distinct isoforms have been found for this gene. WSB1 serves as a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Ubiquitination and degradation of homeodomain-interacting protein kinase 2 by WSB1 has been reported (PMID: 15965468), initiated by the interaction of the two components (PMID: 18093972). WSB1 is also a part of an E3 ubiquitin ligase for the thyroid-hormone-activating type 2 iodothyronine deiodinase (D2) (PMID: 15965468).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2211 Product name: Recombinant human WSB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-280 aa of BC021110 Sequence: MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRV Predict reactive species\nFull Name: WD repeat and SOCS box-containing 1\nCalculated Molecular Weight: 421 aa, 47 kDa\nObserved Molecular Weight: 56 kDa\nGenBank Accession Number: BC021110\nGene Symbol: WSB1\nGene ID (NCBI): 26118\nRRID: AB_10949076\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6I7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868991475881,"sku":"11666-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11666-1-ap","provider":"Iright","version":"1.0","type":"link"}