{"product_id":"proteintech-11678-1-ap","title":"Proteintech, 11678-1-AP, ARPP-19 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARPP-19 (11678-1-AP) by Proteintech is a Polyclonal antibody targeting ARPP-19 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11678-1-AP targets ARPP-19 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells,  A375 cells,  A549 cells,  mouse brain tissue,  rat skeletal muscle tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A375 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARPP-19, a 19-kDa cAMP-regulated phosphoprotein, plays a role in regulating mitosis. Initiation and maintenance of mitosis require the activation of protein kinase cyclin B-Cdc2 and the inhibition of protein phosphatase 2A (PP2A). When phosphorylated by protein kinase Greatwall (Gwl), ARPP-19 associate with and inhibit PP2A, thus promoting mitotic entry. ARPP-19 may be an important link between nerve growth factor (NGF) signaling and post-transcriptional control of neuronal gene expression such as GAP-43.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2279 Product name: Recombinant human ARPP-19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC003418 Sequence: MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG Predict reactive species\nFull Name: cyclic AMP phosphoprotein, 19 kD\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 19 kDa\nGenBank Accession Number: BC003418\nGene Symbol: ARPP-19\nGene ID (NCBI): 10776\nRRID: AB_2060078\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56211\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868962803881,"sku":"11678-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11678-1-ap","provider":"Iright","version":"1.0","type":"link"}