{"product_id":"proteintech-11685-1-ap","title":"Proteintech, 11685-1-AP, PLEK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLEK2 (11685-1-AP) by Proteintech is a Polyclonal antibody targeting PLEK2 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n11685-1-AP targets PLEK2 in WB, IHC, IF\/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, U2OS cells,  Caco-2 cells,  PC-3 cells\nPositive IP detected in: HT-29 cells\nPositive IHC detected in: human pancreas cancer tissue,  mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HT-29 cells\nPositive FC (Intra) detected in: HT-29 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLEK2 belongs to the Pleckstrin homology domain family and is a 40-kDa protein containing the prototypic PH domains at its amino and carboxyl termini(PMID: 10419454). PLEK2 associates with membrane-bound phosphatidylinositols generated by phosphatidylinositol 3-kinase. PLEK2 interacts with the actin cytoskeleton to induce cell spreading.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2297 Product name: Recombinant human PLEK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-353 aa of BC001226 Sequence: EERDAWAFEITGAIHAGQPGKVQQLHSLRNSFKLPPHISLHRIVDKMHDSNTGIRSSPNMEQGSTYKKTFLGSSLVDWLISNSFTASRLEAVTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKISPKEEISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLT Predict reactive species\nFull Name: pleckstrin 2\nCalculated Molecular Weight: 353 aa, 40 kDa\nObserved Molecular Weight: 38-40 kDa\nGenBank Accession Number: BC001226\nGene Symbol: PLEK2\nGene ID (NCBI): 26499\nRRID: AB_2252364\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NYT0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868880064681,"sku":"11685-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11685-1-ap","provider":"Iright","version":"1.0","type":"link"}