{"product_id":"proteintech-11693-1-ap","title":"Proteintech, 11693-1-AP, GNG2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNG2 (11693-1-AP) by Proteintech is a Polyclonal antibody targeting GNG2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11693-1-AP targets GNG2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGγ2 subunit (Gng2\/GNG2) is one of subunits of the Gβγ-dimer composing heterotrimeric G protein with a Gα-subunit. Heterotrimeric G protein has been reported to be involved in various biological activities including cell proliferation, differentiation, invasion and angiogenesis. It is expressed in a range of foetal tissues as well as adult testis, adrenal gland, brain, white blood cells and lung.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2307 Product name: Recombinant human GNG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-71 aa of BC020774 Sequence: MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), gamma 2\nCalculated Molecular Weight: 71 aa, 8 kDa\nObserved Molecular Weight: 8 kDa\nGenBank Accession Number: BC020774\nGene Symbol: GNG2\nGene ID (NCBI): 54331\nRRID: AB_2263277\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P59768\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869463531689,"sku":"11693-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11693-1-ap","provider":"Iright","version":"1.0","type":"link"}