{"product_id":"proteintech-11711-1-ap","title":"Proteintech, 11711-1-AP, GAR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GAR1 (11711-1-AP) by Proteintech is a Polyclonal antibody targeting GAR1 in WB, IHC, IP, ELISA applications with reactivity to human samples\n11711-1-AP targets GAR1 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGAR1, other named NOLA1, is a subunit of H\/ACA and telomerase. Thought is not required for H\/ACA protein assembly, GAR1 is necessary for ribosome biogenesis and telomere. H\/ACA involves in class specify the sites of uridine-to-pseudouridine. It contains a core domain that flanked by glycine- and arginine-rich(GAR) domains. GAR1 also required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transciptase(TERT) holoenzyme.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2282 Product name: Recombinant human GAR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-217 aa of BC003413 Sequence: MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH Predict reactive species\nFull Name: GAR1 ribonucleoprotein homolog (yeast)\nCalculated Molecular Weight: 217 aa, 22 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC003413\nGene Symbol: GAR1\nGene ID (NCBI): 54433\nRRID: AB_2081845\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NY12\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868893696169,"sku":"11711-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11711-1-ap","provider":"Iright","version":"1.0","type":"link"}