{"product_id":"proteintech-11714-1-ap","title":"Proteintech, 11714-1-AP, IFITM3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFITM3 (11714-1-AP) by Proteintech is a Polyclonal antibody targeting IFITM3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n11714-1-AP targets IFITM3 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  LNCaP cells,  THP-1 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIFITM3, also named as interferon-inducible protein 1-8U, belongs to the CD225 family. It is IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus (WNV), and dengue virus, by inhibiting the early steps of replication. IFITM3 is identified as interferon-induced cellular proteins that restrict infections by retroviruses and filoviruses and of influenza virus and flaviviruses, respectively. IFITM3, the most potent antiviral IFITM, was found to inhibit an uncharacterized early infectious event after VSV endocytosis, but before primary transcription of its viral genome.  IFITM proteins are viral restriction factors that can inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. They differentially restrict the entry of a broad range of enveloped viruses, and modulate cellular tropism independently of viral receptor expression. Catalog#11714-1-AP is a rabbit polyclonal antibody raised against the full-length of human IFITM3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, pig, canine, chicken, goat, african green monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2285 Product name: Recombinant human IFITM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC006794 Sequence: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG Predict reactive species\nFull Name: interferon induced transmembrane protein 3 (1-8U)\nCalculated Molecular Weight: 133 aa, 15 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC006794\nGene Symbol: IFITM3\nGene ID (NCBI): 10410\nRRID: AB_2295684\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q01628\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868825571497,"sku":"11714-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11714-1-ap","provider":"Iright","version":"1.0","type":"link"}