{"product_id":"proteintech-11724-1-ap","title":"Proteintech, 11724-1-AP, LIN28A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIN28A (11724-1-AP) by Proteintech is a Polyclonal antibody targeting LIN28A in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11724-1-AP targets LIN28A in WB, IHC, IF\/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, NCCIT cells,  mouse embryo tissue\nPositive IP detected in: K-562 cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: human embronic stem cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLIN28 is one of the four key human factors (OCT4, SOX2, NANOG and LIN28) used to reprogram human fibroblasts to an embryonic stem (ES) cell-like state known as the induced pluripotent stem (Ips) cell[PMID: 20139967]. LIN28 is a marker of undifferentiated human embryonic stem cells and a cytoplasmic mRNA-binding protein that binds to and enhances the translation of the IGF2 mRNA[PMID: 21057460]. LIN28 has also been shown to bind to the let-7 pre-miRNA and block production of the mature let-7 microRNA in mouse embryonic stem cells[PMID: 22078496]. Affinity purified rabbit anti-LIN28 can be used to demonstrate pluripotency of ES and Ips cells, and to detect LIN28 transgene expression in the process of reprogramming. This antibody is a rabbit polyclonal antibody raised against full length LIN28 of human origin. The calculated molecular weight of LIN28 is 23 kDa, but the modified LIN28 is about 28 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, canine\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2312 Product name: Recombinant human LIN28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-209 aa of BC028566 Sequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVHQSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAKECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQN Predict reactive species\nFull Name: lin-28 homolog (C. elegans)\nCalculated Molecular Weight: 209 aa, 23 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC028566\nGene Symbol: LIN28\nGene ID (NCBI): 79727\nRRID: AB_2135039\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H9Z2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868839858345,"sku":"11724-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11724-1-ap","provider":"Iright","version":"1.0","type":"link"}