{"product_id":"proteintech-11742-1-ap","title":"Proteintech, 11742-1-AP, SPRR3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPRR3 (11742-1-AP) by Proteintech is a Polyclonal antibody targeting SPRR3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n11742-1-AP targets SPRR3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  human liver tissue\nPositive IP detected in: COLO 320 cells\nPositive IHC detected in: human colon cancer tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPRR3, also named as Esophagin, Cornifin beta and SPRC, belongs to the cornifin (SPRR) family.  It is cross-linked envelope protein of keratinocytes. Increased expression of SPRR3 appears to be involved in colorectal tumorigenesis. SPRR3 is a marker for terminal squamous cell differentiation.a potential novel therapeutic target for less advanced stages of Breast Cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2337 Product name: Recombinant human SPRR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-161 aa of BC017802 Sequence: MSSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKVPEPCPSTVTPGPAQQKTKQK Predict reactive species\nFull Name: small proline-rich protein 3\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 22-25 kDa\nGenBank Accession Number: BC017802\nGene Symbol: SPRR3\nGene ID (NCBI): 6707\nRRID: AB_2195272\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBC9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868930330793,"sku":"11742-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11742-1-ap","provider":"Iright","version":"1.0","type":"link"}