{"product_id":"proteintech-11768-1-ap","title":"Proteintech, 11768-1-AP, PANK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PANK1 (11768-1-AP) by Proteintech is a Polyclonal antibody targeting PANK1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n11768-1-AP targets PANK1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, SW 1990 cells,  HeLa cells,  human heart tissue,  MCF-7 cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPANK1(Pantothenate kinase 1) is also named as PANk and belongs to the type II pantothenate kinase family. The PANK1 protein, which catalyzes the rate-limiting step of coenzyme A biosynthesis, is also upregulated by p53(PMID:20833636). It also catalyzes the cytosolic phosphorylation of pantothenate (vitamin B5) and derivatives. This protein has 4 isoforms produced by alternative splicing with the molecular weight of 64 kDa, 42 kDa, 36kDa and 45 kDa,respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2324 Product name: Recombinant human PANK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 462-598 aa of BC026296 Sequence: MAAKGDSTNVDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEKRDSISKEDLARATLVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGALLELFKMTDDK Predict reactive species\nFull Name: pantothenate kinase 1\nCalculated Molecular Weight: 598 aa, 64 kDa\nObserved Molecular Weight: 61-64 kDa, 40-45 kDa\nGenBank Accession Number: BC026296\nGene Symbol: PANK1\nGene ID (NCBI): 53354\nRRID: AB_2158913\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TE04\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869421064361,"sku":"11768-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11768-1-ap","provider":"Iright","version":"1.0","type":"link"}