{"product_id":"proteintech-11787-1-ap","title":"Proteintech, 11787-1-AP, MPZL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MPZL2 (11787-1-AP) by Proteintech is a Polyclonal antibody targeting MPZL2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n11787-1-AP targets MPZL2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HaCaT cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMPZL2 (myelin protein zero-like 2), also named as EVA (epithelial V-like antigen) or EVA1, is a type 1 transmembrane protein of the myelin P0 protein family, containing an Ig-like V-type (immunoglobulin-like) domain and two potential glycosylation sites. MPZL2 is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. Its capacity to mediate cell adhesion through a homophilic interaction and its selective regulation by T cell maturation might imply the participation of EVA in the earliest phases of thymus organogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2419 Product name: Recombinant human MPZL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC017774 Sequence: MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFSSFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGNPERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHTVRFSEIHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEERLNQEKKVSVYLEDTD Predict reactive species\nFull Name: myelin protein zero-like 2\nCalculated Molecular Weight: 215 aa, 24 kDa\nObserved Molecular Weight: 24-30 kDa\nGenBank Accession Number: BC017774\nGene Symbol: MPZL2\nGene ID (NCBI): 10205\nRRID: AB_2282054\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O60487\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868925939881,"sku":"11787-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11787-1-ap","provider":"Iright","version":"1.0","type":"link"}