{"product_id":"proteintech-11790-1-ap","title":"Proteintech, 11790-1-AP, DIO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DIO1 (11790-1-AP) by Proteintech is a Polyclonal antibody targeting DIO1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n11790-1-AP targets DIO1 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, HeLa cells,  mouse ovary tissue,  rat lung tissue,  U-937 cells,  A549 cells\nPositive IHC detected in: human liver cancer tissue, human kidney tissue,  human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDIO1(Type I iodothyronine deiodinase) is also named as ITDI1, TXDI1,5DI,DIOI and belongs to the iodothyronine deiodinase family.It is a membrane selenoprotein that catalyzes the deiodination of L-thyroxine to the biologically active thyroid hormone 3,3′,5-triiodothyronine.DIO1 is located in liver, kidney, and thyroid,which has both ORD and IRD activities(PMID: 9389495). It has some isoforms produced by alternative splicing with the MW of 29 kDa, 21 kDa, 13 kDa, 23 kDa, 19 kDa, 4 kDa, 13 kDa, 9 kDa and 10 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2410 Product name: Recombinant human DIO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-125 aa of BC017955 Sequence: GLPQPGLWLKRLWVLLEVAVHVVVGKVLLILFPDRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCT Predict reactive species\nFull Name: deiodinase, iodothyronine, type I\nCalculated Molecular Weight: 249 aa, 29 kDa\nObserved Molecular Weight: 29 kDa, 13 kDa\nGenBank Accession Number: BC017955\nGene Symbol: DIO1\nGene ID (NCBI): 1733\nRRID: AB_10949197\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49895\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868905656489,"sku":"11790-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11790-1-ap","provider":"Iright","version":"1.0","type":"link"}