{"product_id":"proteintech-11798-1-ap","title":"Proteintech, 11798-1-AP, BUD31 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BUD31 (11798-1-AP) by Proteintech is a Polyclonal antibody targeting BUD31 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11798-1-AP targets BUD31 in WB, IHC, IF, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  hESC cells,  human brain tissue,  Jurkat cells,  mouse heart tissue,  mouse liver tissue,  mouse lung tissue,  Raji cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2373 Product name: Recombinant human BUD31 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-144 aa of BC022821 Sequence: MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG Predict reactive species\nFull Name: BUD31 homolog (S. cerevisiae)\nCalculated Molecular Weight: 144 aa, 17 kDa\nObserved Molecular Weight: 17-20 kDa\nGenBank Accession Number: BC022821\nGene Symbol: BUD31\nGene ID (NCBI): 8896\nRRID: AB_2274894\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P41223\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868993671337,"sku":"11798-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11798-1-ap","provider":"Iright","version":"1.0","type":"link"}