{"product_id":"proteintech-11800-1-ap","title":"Proteintech, 11800-1-AP, POPDC3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe POPDC3 (11800-1-AP) by Proteintech is a Polyclonal antibody targeting POPDC3 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11800-1-AP targets POPDC3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, HEK-293 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse heart tissue, human skeletal muscle tissue,  human placenta tissue,  human testis tissue,  human spleen tissue,  human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Popeye domain-containing (POPDC) gene family includes BVES\/POPDC1, POPDC2 and POPDC3. POPDC proteins are highly evolutionarily conserved transmembrane proteins expressed in embryonic epithelium, heart and muscle. POPDC3 is a 291-amino acid protein containing three putative transmembrane domains. It has been reported that POPDC3 expression is reduced in gastric cancer, suggesting it might play an important role in the progression and metastases of gastric cancer. (PMID: 10882522; 20627872; 22654436)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2375 Product name: Recombinant human POPDC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-291 aa of BC022323 Sequence: MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLGFLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLGISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQFLDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK Predict reactive species\nFull Name: popeye domain containing 3\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC022323\nGene Symbol: POPDC3\nGene ID (NCBI): 64208\nRRID: AB_2166494\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HBV1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869423685801,"sku":"11800-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11800-1-ap","provider":"Iright","version":"1.0","type":"link"}