{"product_id":"proteintech-11814-1-ap","title":"Proteintech, 11814-1-AP, RFC3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RFC3 (11814-1-AP) by Proteintech is a Polyclonal antibody targeting RFC3 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n11814-1-AP targets RFC3 in WB, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human liver tissue,  HeLa cells,  human heart tissue\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRFC3, also known as RFC38, is a 356 amino acid protein, which localizes in nucleus. Replication factor C (RFC) is a component of the eukaryotic DNA polymerase . In all eukaryotic cell cycles, it is essential for DNA duplication, DNA injury repair and checkpoint control. RFC consists of five subunits (RFC1-5). The interrelationships between RFC2, RFC3 and the c-MYC oncogene (transcription factor) can induce cell division and proliferation. RFC3 is associated with liver, breast, esophageal and ovarian cancer, and serves a critical role in cellular proliferation, invasion and metastasis. RFC3 exists two isoforms with molecular weight of 34 kDa and 38-40 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2269 Product name: Recombinant human RFC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-356 aa of BC000149 Sequence: MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF Predict reactive species\nFull Name: replication factor C (activator 1) 3, 38kDa\nCalculated Molecular Weight: 40 aa, 6 kDa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC000149\nGene Symbol: RFC3\nGene ID (NCBI): 5983\nRRID: AB_2178470\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P40938\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869008810153,"sku":"11814-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11814-1-ap","provider":"Iright","version":"1.0","type":"link"}